PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04522.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 170aa    MW: 19081.1 Da    PI: 6.9473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04522.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.89.2e-123467135
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35
                     +g+W+++Ed +l ++v+q+G+++W++I+r++  gR
       KHN04522.1 34 KGPWSAQEDRILTRLVEQYGPRNWSLISRYIK-GR 67
                     79*****************************8.87 PP

2Myb_DNA-binding32.12.7e-1066902247
                     T-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 22 gtWktIartmgkgRtlkqcksrwqky 47
                     g+W+tIar ++ gRt++ +k++w++ 
       KHN04522.1 66 GRWATIARLLP-GRTDNAVKNHWNST 90
                     45*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-112863IPR009057Homeodomain-like
PROSITE profilePS5129422.4782995IPR017930Myb domain
SMARTSM007171.6E-153393IPR001005SANT/Myb domain
PfamPF002492.4E-153490IPR001005SANT/Myb domain
SuperFamilySSF466897.1E-163492IPR009057Homeodomain-like
CDDcd001674.52E-133691No hitNo description
Gene3DG3DSA:1.10.10.601.9E-116494IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MEEMNRSSSS TSSSSHCCSL ESNHRSPNKP DRIKGPWSAQ EDRILTRLVE QYGPRNWSLI  60
SRYIKGRWAT IARLLPGRTD NAVKNHWNST LKRRAKGINV NVNDADNEDD PLTALTLAPP  120
GIANATLTED AVPDHRASPE SAAEGFWDMM RDVIAREVRE YVSSNFSDNN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311871e-167KT031187.1 Glycine max clone HN_CCL_39 MYB/HD-like transcription factor (Glyma04g03910.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578007.11e-101PREDICTED: transcription factor MYB44-like
TrEMBLA0A0B2PA721e-123A0A0B2PA72_GLYSO; Transcription factor MYB44
STRINGGLYMA04G03910.11e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.16e-25myb domain protein 77
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]